PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004047
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 280aa    MW: 31928.3 Da    PI: 4.3787
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58688652PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-47633PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1950103356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++++q+++Le+ Fe+++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Lsa004047  50 KKRRLSADQVKALEKNFEMENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 103
                56689************************************************9 PP

2HD-ZIP_I/II131.82.6e-4249141193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls++qvk+LE++Fe+e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk+++d+lk++ ++L++++e+L ++++e
    Lsa004047  49 EKKRRLSADQVKALEKNFEMENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANFDSLKHNYDSLKHDNESLLKQIRE 141
                  69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-2037107IPR009057Homeodomain-like
PROSITE profilePS5007117.76745105IPR001356Homeobox domain
SMARTSM003893.6E-1848109IPR001356Homeobox domain
PfamPF000469.0E-1750103IPR001356Homeobox domain
CDDcd000861.71E-1650106No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2152112IPR009057Homeodomain-like
PRINTSPR000317.3E-67685IPR000047Helix-turn-helix motif
PROSITE patternPS00027080103IPR017970Homeobox, conserved site
PRINTSPR000317.3E-685101IPR000047Helix-turn-helix motif
PfamPF021832.2E-18105146IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MAGLIPMCQT IDESSSPVGY TREFQSMLME GLDEDGGGDD CAGGGQISEK KRRLSADQVK  60
ALEKNFEMEN KLEPERKVKL AQELGLQPRQ VAVWFQNRRA RWKTKQLERD YGVLKANFDS  120
LKHNYDSLKH DNESLLKQIR ELKSKLYGED EESNIPVKEE ADEKQPKSPE VMYENENMVT  180
TTYFPDLKDG SSDSDSSAIL NDDNNSSNMT TSMADVMKGH QLTESKDIMG AAQKAYQPQF  240
VKIEEHNFFG GDESCNFFSD DQAPTLQWYC QDQWNLTDEN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197105RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031070.11e-106PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
SwissprotQ940J17e-79ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A103Y6041e-161A0A103Y604_CYNCS; Helix-turn-helix motif-containing protein
STRINGPOPTR_0005s07290.11e-104(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.13e-71homeobox protein 6